PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2389_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ZF-HD
Protein Properties Length: 311aa    MW: 34943.9 Da    PI: 8.325
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2389_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.42.6e-3195150359
                          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                          ++rY+eClkNhAa+ G h+vDGCgEfmps geegt++al+CaAC+CHRnFHRre e+
  cra_locus_2389_iso_1_len_1402_ver_3  95 SIRYRECLKNHAANKGRHVVDGCGEFMPS-GEEGTPEALRCAACDCHRNFHRREREN 150
                                          789*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2095149IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.0E-3096148IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.1E-2997147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.85498147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.69E-18239308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-27243309IPR009057Homeodomain-like
PROSITE profilePS500718.681245309IPR001356Homeobox domain
TIGRFAMsTIGR015653.4E-27247304IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MELREEQKKE NIPNSITYHP SSSLYHESSA EAEAEAASAS AAAASILPES RRRNHEPVVL  60
GRPGQTLDQP HLIHHHPDPD PAPAAASGTI TNNTSIRYRE CLKNHAANKG RHVVDGCGEF  120
MPSGEEGTPE ALRCAACDCH RNFHRREREN DYQAIATTSR HGSVLFPPHS HHQPFTMLPQ  180
AQQHRQHKYS FTNSPTAPIM MTFGGGSSGG GGGPAESSSE DLNIFHCETA QGVVANFNYN  240
QSFSVSKKRI RTKFTQLQKE KMHEFAEKLG WKIQKQNEEE VQQFCHEFGV KRQVFKVWMH  300
NNKQAMKRKQ M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-202463051675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804697.15e-94PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW71e-64ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A068U3224e-91A0A068U322_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000090333e-88(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128